PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa19g035950.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family GATA
Protein Properties Length: 263aa    MW: 29040.7 Da    PI: 8.4945
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa19g035950.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA61.21.3e-19185219135
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                     C++Cg+ kTp+WR gp g+ktLCnaCG++y++ +l
  Csa19g035950.1 185 CQHCGAEKTPQWRAGPLGPKTLCNACGVRYKSGRL 219
                     *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.0E-15179229IPR000679Zinc finger, GATA-type
SuperFamilySSF577168.08E-15182242No hitNo description
PROSITE profilePS5011411.873182215IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.108.4E-15183217IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.39E-14184231No hitNo description
PROSITE patternPS003440185210IPR000679Zinc finger, GATA-type
PfamPF003203.8E-17185219IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MEMESFMDDL LNFSVPEEEE EDEAQPPRNI TRRKTGIRQT DPLGLFNHGD HGVVEEEDLE  60
WISNKDAFPV IETFVGVLPL SEHFGVTSPE REAIEGKQRS PVSVLETSSN SSTTTTTSNS  120
SGGSTAVTTT TTSMLMSCCV SFKAPAKARS KRRRTGRRDL RVLWTGNEIQ KKKTISAAVI  180
IGRKCQHCGA EKTPQWRAGP LGPKTLCNAC GVRYKSGRLV PEYRPANSPT FTAELHSNSH  240
RKIVEMRKQY QSGDGDHRKV CG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0244971e-178BT024497.1 Arabidopsis thaliana At3g24050 mRNA, complete cds.
GenBankY136481e-178Y13648.1 Arabidopsis thaliana mRNA for GATA transcription factor 1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010488502.10.0PREDICTED: GATA transcription factor 1-like isoform X1
SwissprotQ8LAU91e-123GATA1_ARATH; GATA transcription factor 1
TrEMBLR0HN961e-125R0HN96_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.3__2631__AT3G24050.11e-122(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM129872430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.17e-61GATA transcription factor 1